Online Inquiry
TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody
SPA-10710
Size | Price |
200 µg | Online Inquiry |
50 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | THRA |
Gene Abbr. | THRA |
Gene ID | 7067 |
Full Name | thyroid hormone receptor alpha |
Alias | AR7, CHNG6, EAR7, ERB-T-1, ERBA |
Introduction | Thyroid hormones regulate general metabolism and normal cellular growth and development. These actions are regulated by the thyroid hormone receptor (TR), a ligand-dependent transcriptional factor. At least two genes and several isoforms encode TR. Recent studies have implicated a role of TRs in thyroid hormone-induced apoptosis in larval tissues and proliferation of adult cell types. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: AFEHYVNHRKHNIPHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQLGEAGSLQGPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSE. |
Usage | |
---|---|
Application | IF, IHC |
Dilutions | Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:50-1:200) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human TR alpha/NR1A1/Thyroid Hormone Receptor alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.