TMEM55B Antibody - CD BioSciences

service-banner

TMEM55B Antibody

TMEM55B Antibody

SPA-10787

Size Price
0.1 mL Online Inquiry
25 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name TMEM55B
Gene Abbr. PIP4P1
Gene ID 90809
Full Name phosphatidylinositol-4,5-bisphosphate 4-phosphatase 1
Alias C14orf9, TMEM55B
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: GHPAVLPGEDPPPYSPLTSPDSGSAPMITCRVCQS.
Usage
Application WB, IHC
Dilutions Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:20-1:50)
Reactivity Human, Mouse, Rat
Specificity Specificity of human TMEM55B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.