Online Inquiry
TMED4 Antibody
SPA-10784
| Size | Price |
| 0.025 mg | Online Inquiry |
| 0.1 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | TMED4 |
| Gene Abbr. | TMED4 |
| Gene ID | 222068 |
| Full Name | transmembrane p24 trafficking protein 4 |
| Alias | ERS25, GMP25iso, HNLF, p24a3, p24alpha3 |
| Introduction | A putative NF-kB activating protein. Also known as Transmembrane emp24 protein transport domain containing 4. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Immunogen | Synthetic peptide directed towards the N-terminal region of human TMED4. Peptide sequence: LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rabbit, Zebrafish |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS, 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.