Online Inquiry
THRAP3 Antibody
SPA-10722
Size | Price |
0.1 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | THRAP3 |
Gene Abbr. | THRAP3 |
Gene ID | 9967 |
Full Name | thyroid hormone receptor associated protein 3 |
Alias | BCLAF2, TRAP150 |
Introduction | Thyroid hormone receptors (TRs) are ligand dependent members of the steroid/retinoic acid superfamily of transcription factors. The two genes encoding TRs identified to date, TR alpha and TR beta, have been mapped to human chromosomes 17 and 3, respectively. TRs bind to thyroid hormone response elements (TREs) with half site binding motifs in the orientation of palindromes, direct repeats, or inverted palindromes. The affinities of binding are both variable and influenced differentially by 3,5,3 triiodo L thyronine (T3). Thyroid hormones, through their interaction with the thyroid receptor (TR), effect metabolic processes, growth and development in many tissues by regulating the expression of genes for growth hormone, malic enzyme and several hepatic proteins. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to the following amino acid sequence: RGKRSEGGHRGFVPEKNFRVTAYKAVQEKSSSPPPRKTSESRDKLGAKGDFPTGKSSFSITREAQVNVRMDSFDEDLARPSGL. |
Usage | |
---|---|
Application | IF |
Dilutions | Immunofluorescence (0.25-2 µg/mL) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human THRAP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.