TASK-5/KCNK15 Antibody - CD BioSciences

service-banner

TASK-5/KCNK15 Antibody

TASK-5/KCNK15 Antibody

SPA-10605

Size Price
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name TASK-5/KCNK15
Gene Abbr. KCNK15
Gene ID 60598
Full Name potassium two pore domain channel subfamily K member 15
Alias K2p15.1, KCNK11, KCNK14, KT3.3, TASK-5
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the middle region of human TASK-5/KCNK15. Peptide sequence: ARSVGSASVFCHVHKLERCARDNLGFSPPSSPGVVRGGQAPRPGARWKSI The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Reactivity Human, Porcine, Canine
Storage & Handling
Storage Buffer PBS, 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.