Online Inquiry
Synaptojanin 1 Antibody
SPA-10491
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Synaptojanin 1 |
| Gene Abbr. | SYNJ1 |
| Gene ID | 8867 |
| Full Name | synaptojanin 1 |
| Alias | DEE53, EIEE53, INPP5G, PARK20 |
| Introduction | Synaptojanin-1 is a phosphatidylinositol (4,5)-bisphosphate (PI(4,5)P2) that has a role in clathrin-coated pit dynamics Perera et al. (2006) [PubMed 17158794].[supplied by OMIM] |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | 1A2 |
| Isotype | IgG1 Kappa |
| Immunogen | SYNJ1 (NP_003886, 1474 a.a. ~ 1573 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KISNPKGWVTFEEEEDFGVKGKSKSACSDLLGNQPSSFSGSNLTLNDDWNKGTNVSFCVLPSRRPPPPPVPLLPPGTSPPVDPFTTLASKASPTLDFTER. |
| Usage | |
|---|---|
| Application | WB, ELISA |
| Reactivity | Human |
| Specificity | SYNJ1 - synaptojanin 1. |
| Storage & Handling | |
|---|---|
| Storage Buffer | In 1X PBS, pH 7.4. |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.