Online Inquiry
Sulfatase 1 Antibody
SPA-10432
Size | Price |
0.1 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Sulfatase |
Gene Abbr. | SULF1 |
Gene ID | 23213 |
Full Name | sulfatase 1 |
Alias | SULF-1 |
Introduction | Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF1, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules (Dai et al., 2005 [PubMed 16192265]).[supplied by OMIM] |
Product Details | |
---|---|
Host | Mouse |
Clonality | Monoclonal |
Clone No. | 1A4 |
Isotype | IgM Kappa |
Immunogen | SULF1 (NP_055985.1, 780 a.a. ~ 871 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG. |
Usage | |
---|---|
Application | WB, ELISA, IHC |
Dilutions | Western Blot (1:500); ELISA (1:100-1:2000); Immunohistochemistry (1:10-1:500) |
Reactivity | Human, Mouse |
Specificity | SULF1 - sulfatase 1. |
Storage & Handling | |
---|---|
Storage Buffer | Ascites. |
Preservative | No Preservative |
Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.