Online Inquiry
SPAG9 Antibody
SPA-10256
Size | Price |
100 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | SPAG9 |
Gene Abbr. | SPAG9 |
Gene ID | 9043 |
Full Name | sperm associated antigen 9 |
Alias | CT89, HLC-6, HLC4, HLC6, JIP-4 |
Introduction | Extracellular signals are transduced into cells through mitogen-activated protein kinases. The structural organization of these kinases into specific signaling domains is facilitated by scaffolding proteins involved in closely tethering different kinases so that successive phosphorylation events can occur. The protein encoded by this gene is a scaffolding protein that brings together mitogen-activated protein kinases and their transcription factor targets for the activation of specific signaling pathways. This gene which is abundantly expressed in testicular haploid germ cells encodes a protein that is recognized by sperm-agglutinating antibodies and implicated in infertility. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: SGQVDKASLCGSMTSNSSAETDSLLGGITVVGCSAEGVTGAATSPSTNGASPVMDKPPEMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQTGVYTEHVFTDPLGVQIPEDLSPVYQSSN. |
Usage | |
---|---|
Application | IF, IHC |
Dilutions | Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:200-1:500) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human SPAG9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.