Online Inquiry
Somatostatin Antibody
SPA-10227
Size | Price |
0.1 mL | Online Inquiry |
0.025 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Somatostatin |
Gene Abbr. | SST |
Gene ID | 6750 |
Full Name | somatostatin |
Alias | SMST, SST1 |
Introduction | The cyclic tetradecapeptide somatostatin is widely distributed throughout the body and is an important regulator of endocrine and nervous system function. It exerts its biologic actions by binding to specific high affinity receptors on the cell surface. Somatostatin inhibits the release of somatotropin. Somatostatin has also been shown in sympathetic nerves, mucosal cells, myenteric nerves of the gastrointestinal tract, salivary glands and in some parafollicular cells of the thyroid. Somatostatin positive cells may also be present in medullary thyroid carcinomas, C cell hyperplasia, thymic and lung tumors and pulmonary small cell carcinomas. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: APSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKN. |
Usage | |
---|---|
Application | WB, IHC |
Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:1000-1:2500) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human Somatostatin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.