Smek2 Antibody - CD BioSciences

service-banner

Smek2 Antibody

Smek2 Antibody

SPA-10133

Size Price
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name Smek2
Gene Abbr. PPP4R3B
Gene ID 57223
Full Name protein phosphatase 4 regulatory subunit 3B
Alias FLFL2, PP4R3B, PSY2, SMEK2, smk1
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the C-terminal region of human SMEK2. Peptide sequence: EKPKPEDDFPDNYEKFMETKKAKESEDKENLPKRTSPGGFKFTFSHSASA The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Reactivity Human
Storage & Handling
Storage Buffer PBS, 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.