Online Inquiry
SIT1 Antibody
SPA-10031
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | SIT1 |
| Gene Abbr. | SIT1 |
| Gene ID | 27240 |
| Full Name | signaling threshold regulating transmembrane adaptor 1 |
| Alias | SIT, SIT-R |
| Introduction | SIT1 (SHP-2-interacting transmembrane adapter 1; also signaling threshold-regulating transmembrane adapter 1) is a 35‑40 kDa type I transmembrane glycoprotein that belongs to a diverse group of transmembrane adapter proteins. It is expressed on thymocytes, plasma cells and T cells. When engaged, SIT1 downregulates TCR signaling. Mature human SIT1 is 172 amino acids (aa) in length. It contains a short extracellular domain (aa 25‑40) that undergoes homodimerization and an extensive intracellular region (aa 62‑196) that contains three key phosphorylation sites (Tyr90/169/188). Over aa 65‑196, human SIT1 is 86% and 80% aa identical to canine and mouse SIT1, respectively. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: GRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCY TSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTR. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:50-1:200) |
| Reactivity | Human |
| Specificity | Specificity of human SIT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.