SIRPB2 Antibody - CD BioSciences

service-banner

SIRPB2 Antibody

SIRPB2 Antibody

SPA-10009

Size Price
0.1 mL Online Inquiry
25 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name SIRPB2
Gene Abbr. SIRPB2
Gene ID 284759
Full Name signal regulatory protein beta 2
Alias PTPN1L, PTPNS1L3, dJ776F14.2
Introduction Signal-regulatory protein beta-2(SIRP-beta-2), is a ~37 kDa monomeric single pass type I membrane glycoprotein. It belongs to the SIRP/SHPS (CD172) family of the immunoglobulin (Ig) superfamily. The SIRP family are paired receptors that have similar extracellular domains but differing C-terminal domains and functions. SIRP-beta-2 contains an N-terminal signal peptide (aa1-32), two extracellular Ig-like domains: a V-type 1 (aa 33-143) and a V-type 2 (aa 157-258) containing three potential N-linked glycosylation sites, a helical transmembrane domain (aa 288-308), and a cytoplasmic domain (aa 309-342).
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: GETLLLRCMVVGSCTDGMIKWVKVSTQDQQEIYNFKRGSFPGVMPMIQRTSEPLNCDYSIYIHNVTREHTGTYHCVRFDGLSEHSEMKSDEGTSVLVKGAGDPEPDLWIIQPQELVLGTTGDTVFLNCTV.
Usage
Application IF, IHC
Dilutions Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:50-1:200)
Reactivity Human
Specificity Specificity of human SIRPB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.