Online Inquiry
SIRPB2 Antibody
SPA-10009
Size | Price |
0.1 mL | Online Inquiry |
25 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | SIRPB2 |
Gene Abbr. | SIRPB2 |
Gene ID | 284759 |
Full Name | signal regulatory protein beta 2 |
Alias | PTPN1L, PTPNS1L3, dJ776F14.2 |
Introduction | Signal-regulatory protein beta-2(SIRP-beta-2), is a ~37 kDa monomeric single pass type I membrane glycoprotein. It belongs to the SIRP/SHPS (CD172) family of the immunoglobulin (Ig) superfamily. The SIRP family are paired receptors that have similar extracellular domains but differing C-terminal domains and functions. SIRP-beta-2 contains an N-terminal signal peptide (aa1-32), two extracellular Ig-like domains: a V-type 1 (aa 33-143) and a V-type 2 (aa 157-258) containing three potential N-linked glycosylation sites, a helical transmembrane domain (aa 288-308), and a cytoplasmic domain (aa 309-342). |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: GETLLLRCMVVGSCTDGMIKWVKVSTQDQQEIYNFKRGSFPGVMPMIQRTSEPLNCDYSIYIHNVTREHTGTYHCVRFDGLSEHSEMKSDEGTSVLVKGAGDPEPDLWIIQPQELVLGTTGDTVFLNCTV. |
Usage | |
---|---|
Application | IF, IHC |
Dilutions | Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:50-1:200) |
Reactivity | Human |
Specificity | Specificity of human SIRPB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.