Online Inquiry
SEC14L3 Antibody
SPA-09871
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | SEC14L3 |
| Gene Abbr. | SEC14L3 |
| Gene ID | 266629 |
| Full Name | SEC14 like lipid binding 3 |
| Alias | TAP2 |
| Introduction | SEC14L3 is a probable hydrophobic ligand-binding protein; It may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to the C terminal of Sec14l3. Immunizing peptide sequence RDQVKTQYEHSVQISRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFL. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1:100-1:2000) |
| Reactivity | Rat, Human, Mouse, Bovine, Canine, Equine, Guinea Pig, Rabbit |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.