Online Inquiry
SC5DL Antibody
SPA-09864
| Size | Price |
| 100 µL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | SC5DL |
| Gene Abbr. | SC5DL |
| Gene ID | 6309 |
| Full Name | sterol-C5-desaturase |
| Alias | ERG3, S5DES, SC5DL |
| Introduction | SC5DL catalyzes a dehydrogenation to introduce C5-6 double bond into lathosterol.This gene encodes an enzyme of cholesterol biosynthesis. The encoded protein catalyzes the conversion of lathosterol into 7-dehydrocholesterol. Mutations in this gene have been associated with lathosterolosis. Alternatively spliced transcript variants encoding the same protein have been described. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to SC5DL(sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, S. cerevisiae)-like) The peptide sequence was selected from the N terminal of SC5DL. Peptide sequence NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLG The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1:100-1:2000) |
| Reactivity | Human |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.