Ryk Antibody - CD BioSciences

service-banner

Ryk Antibody

Ryk Antibody

SPA-09802

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name Ryk
Gene Abbr. RYK
Gene ID 6259
Full Name receptor like tyrosine kinase
Alias D3S3195, JTK5, JTK5A, RYK1
Introduction Ryk (related to tyrosine (Y) kinase; also VIK and MRK) is a member of the tyrosine protein kinase family. It is a type I transmembrane glycoprotein that binds Wnt and forms a Wnt receptor complex with frizzled. In this capacity, it serves as a link between Wnt and Dishevelled. Mouse Ryk is 594 amino acids (aa) in length. It contains a 177 aa extracellular region (aa 35‑211) that shows one WIF-1-like domain (aa 51‑180), and a cytoplasmic region that possesses a nonfunctional Ser/Thr protein kinase domain (aa 318‑581). There is one alternate start site at Met117. Over aa 35‑211, mouse Ryk is 94% aa identical to human Ryk, and shows absolute (100%) aa identity to rat Ryk.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: LWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALG.
Usage
Application IF
Dilutions Immunofluorescence (0.25-2 µg/mL)
Reactivity Human, Mouse, Rat
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.