Online Inquiry
Ryk Antibody
SPA-09801
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Ryk |
| Gene Abbr. | RYK |
| Gene ID | 6259 |
| Full Name | receptor like tyrosine kinase |
| Alias | D3S3195, JTK5, JTK5A, RYK1 |
| Introduction | Ryk (related to tyrosine (Y) kinase; also VIK and MRK) is a member of the tyrosine protein kinase family. It is a type I transmembrane glycoprotein that binds Wnt and forms a Wnt receptor complex with frizzled. In this capacity, it serves as a link between Wnt and Dishevelled. Mouse Ryk is 594 amino acids (aa) in length. It contains a 177 aa extracellular region (aa 35‑211) that shows one WIF-1-like domain (aa 51‑180), and a cytoplasmic region that possesses a nonfunctional Ser/Thr protein kinase domain (aa 318‑581). There is one alternate start site at Met117. Over aa 35‑211, mouse Ryk is 94% aa identical to human Ryk, and shows absolute (100%) aa identity to rat Ryk. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: SMKRIELDDSISASSSSQGLSQPSTQTTQYLRADTPNNATPITSSLGYPTLRIEKNDLRSVTLLEAKGKVKDIAISRERITLKDVLQEGTFGRIFHGILIDEKDPNKEKQAFVKTVKDQASEIQVTMMLTESCKLRGLHHRNLLPITH. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:200-1:500) |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human Ryk antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.