Online Inquiry
RXFP4/GPCR142/GPR100 Antibody
SPA-09798
| Size | Price |
| 0.05 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | RXFP4/GPCR142/GPR100 |
| Gene Abbr. | RXFP4 |
| Gene ID | 339403 |
| Full Name | relaxin family peptide/INSL5 receptor 4 |
| Alias | GPCR142, GPR100, RLN3R2, RXFPR4 |
| Introduction | GPR100 is a Bradykinin receptor. This gene is highly homologous to SALPR. Liu et al. 2003 called the gene GPCR142, although it is not the same gene as the putative orphan receptor GPR142. GPR100 has been shown to express widely in the human body. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Immunogen | Synthetic peptide directed towards the C-terminal region of RXFP4/GPCR142/GPR100. Peptide sequence: RDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESRPSTLLTNLDRGTPG The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Reactivity | Human, Porcine |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS, 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.