Online Inquiry
RXFP3/RLN3R1/SALPR Antibody
SPA-09792
| Size | Price |
| 0.05 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | RXFP3/RLN3R1/SALPR |
| Gene Abbr. | RXFP3 |
| Gene ID | 51289 |
| Full Name | relaxin family peptide receptor 3 |
| Alias | GPCR135, RLN3R1, RXFPR3, SALPR |
| Introduction | SALPR/GPCR135 is a relaxin receptor. SALPR has been shown to be expressed in human brain, particularly the substantia nigra and pituitary. SALPR is also expressed at lower levels in peripheral tissues. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWWELGLELPDG. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:200-1:500) |
| Reactivity | Human |
| Specificity | Specificity of human RXFP3/RLN3R1/SALPR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.