RRP7A Antibody - CD BioSciences

service-banner

RRP7A Antibody

RRP7A Antibody

SPA-09786

Size Price
0.1 mL Online Inquiry
25 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name RRP7A
Gene Abbr. RRP7A
Gene ID 27341
Full Name ribosomal RNA processing 7 homolog A
Alias BK126B4.3, CGI-96, Rrp7
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: AYDQKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLERERRKRS.
Usage
Application IF
Dilutions Immunofluorescence (0.25-2 µg/mL)
Reactivity Human, Mouse, Rat
Specificity Specificity of human RRP7A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.