Online Inquiry
RPA14 Antibody
SPA-09747
| Size | Price |
| 0.1 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | RPA14 |
| Gene Abbr. | RPA3 |
| Gene ID | 6119 |
| Full Name | replication protein A3 |
| Alias | REPA3, RP-A p14 |
| Introduction | Replication protein A (RPA) is a single-stranded DNA binding protein. Human RPA is a heterotrimeric protein containing subunits of 70, 32 and 14 kDa. This protein complex is highly conserved in eukaryotes and is essential in DNA replication, homologous recombination and nucleotide excision repair. RPA has been shown to be a target for DNA-dependent protein kinase (DNA-PK) ataxia telangiectasia-mutated gene (ATM) and a cyclin dependent protein kinase. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYP. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:50-1:200) |
| Reactivity | Human |
| Specificity | Specificity of human RPA14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.