Online Inquiry
ROR1 Antibody
SPA-09719
Size | Price |
0.1 mL | Online Inquiry |
0.025 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | ROR1 |
Gene Abbr. | ROR1 |
Gene ID | 4919 |
Full Name | receptor tyrosine kinase like orphan receptor 1 |
Alias | NTRKR1, dJ537F10.1 |
Introduction | ROR1 and ROR2 are orphan receptor tyrosine kinases that are most closely related to MuSK and the Trk family of neurotrophin receptors. They are characterized by the presence of extracellular frizzled-like cysteine-rich domains and membrane-proximal kringle domains, both of which are assumed to mediate protein-protein interactions. The ROR family RTKs are evolutionarily conserved among Caenorhabditis elegans, Drosophila, mice, and humans. Although the functions of ROR kinases are unknown, similarities between ROR and MuSK and Trk kinases have led to speculation that ROR kinases regulate synaptic development. CAM-1, a C. elegans ortholog of the ROR family RTKs, plays several important roles in regulating cellular migration, polarity of asymmetric cell divisions, and axonal outgrowth of neurons during nematode development. mROR1 and mROR2 may play differential roles during the development of the nervous system. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | The immunogen for this antibody is ROR1 - N-terminal region. Peptide sequence TASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITA. The peptide sequence for this immunogen was taken from within the described region. |
Usage | |
---|---|
Application | WB |
Dilutions | Western Blot (1:1000) |
MW(KDa) | 130, 135 |
Reactivity | Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit |
Storage & Handling | |
---|---|
Storage Buffer | PBS and 2% Sucrose. |
Preservative | 0.09% Sodium Azide |
Storage Temp. | Store at -20 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.