Online Inquiry
RNASE11 Antibody
SPA-09680
| Size | Price |
| 0.1 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | RNASE11 |
| Gene Abbr. | RNASE11 |
| Gene ID | 122651 |
| Full Name | ribonuclease A family member 11 (inactive) |
| Alias | C14orf6, HEL-S-84p, RAJ1 |
| Introduction | RNASE11 belongs to the pancreatic ribonuclease family. The function of RNASE11 remains unknown. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to RNASE11(ribonuclease, RNase A family, 11 (non-active)) The peptide sequence was selected from the middle region of RNASE11. Peptide sequence GISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWL. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1:100-1:2000) |
| Reactivity | Human, Equine |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.