RIPK5 Antibody - CD BioSciences

service-banner

RIPK5 Antibody

RIPK5 Antibody

SPA-09673

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name RIPK5
Gene Abbr. DSTYK
Gene ID 25778
Full Name dual serine/threonine and tyrosine protein kinase
Alias CAKUT1, DustyPK, HDCMD38P, RIP5, RIPK5
Introduction This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. Multiple alternatively spliced transcript variants have been found, but the biological validity of some variants has not been determined.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptides corresponding to RIPK5(receptor interacting protein kinase 5) The peptide sequence was selected from the middle region of RIPK5. Peptide sequence EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS. The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Dilutions Western Blot (1:100-1:2000)
Reactivity Human, Rat, Canine, Guinea Pig
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.