Online Inquiry
RIPK4 Antibody
SPA-09669
| Size | Price |
| 0.1 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | RIPK4 |
| Gene Abbr. | RIPK4 |
| Gene ID | 54101 |
| Full Name | receptor interacting serine/threonine kinase 4 |
| Alias | ANKK2, ANKRD3, CHANDS, DIK, NKRD3 |
| Introduction | The protein encoded by this gene is a serine/threonine protein kinase that interacts with protein kinase C-delta. The encoded protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation. [provided by RefSeq] |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to RIPK4(receptor-interacting serine-threonine kinase 4) The peptide sequence was selected from the middle region of RIPK4. Peptide sequence GLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (0.2-1 µg/mL) |
| Reactivity | Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.