Online Inquiry
RIP5/C20orf24 Antibody
SPA-09659
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | RIP5/C20orf24 |
| Gene Abbr. | RAB5IF |
| Gene ID | 55969 |
| Full Name | RAB5 interacting factor |
| Alias | C20orf24, PNAS-11, RCAF1, RIP5 |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptide directed towards the N terminal of human C20orf24. Peptide sequence MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEFLDVIYWFRQ. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1:1000) |
| Reactivity | Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit, Yeast |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.