RIP5/C20orf24 Antibody - CD BioSciences

service-banner

RIP5/C20orf24 Antibody

RIP5/C20orf24 Antibody

SPA-09658

Size Price
0.1 mL Online Inquiry
25 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name RIP5/C20orf24
Gene Abbr. RAB5IF
Gene ID 55969
Full Name RAB5 interacting factor
Alias C20orf24, PNAS-11, RCAF1, RIP5
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: KEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEF.
Usage
Application IF, IHC
Dilutions Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:500-1:1000)
Reactivity Human, Mouse, Rat
Specificity Specificity of human RIP5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.