Online Inquiry
RCAN2 Antibody
SPA-09537
| Size | Price |
| 0.1 mg | Online Inquiry |
| 0.025 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | RCAN2 |
| Gene Abbr. | RCAN2 |
| Gene ID | 10231 |
| Full Name | regulator of calcineurin 2 |
| Alias | CSP2, DSCR1L1, MCIP2, RCN2, ZAKI-4 |
| Introduction | Regulator of calcineurin 2 (RCAN2), also known as ZAKI4 and DSCR1L1, is expressed as two isoforms differing at their N-terminus. The longer of the two (isoform 1) is expressed exclusively in the brain, while isoform 2 is ubiquitously expressed, with highest expression in brain, heart, and muscle. Both isoforms bind to the catalytic subunit of calcineurin, a Ca++-dependent protein phosphatase involved in several neuronal functions, though their C-terminal region and inhibit calcineurin's activity. Unlike isoform 1 of RCAN2, the expression of the second isoform is not induced by the thyroid hormone T3. RCAN2 is a member of a family of three endogenous calcineurin regulators that are located near the minimal supernumerary fragment of chromosome 21 in individuals with Down syndrome, suggesting that they play a role in this syndrome. Multiple isoforms of RCAN2 are known to exist. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptide directed towards the middle region of human RCAN2The immunogen for this antibody is RCAN2. Peptide sequence LHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVG. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1:1000) |
| Reactivity | Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.