Online Inquiry
RBCK1 Antibody
SPA-09528
Size | Price |
0.1 mL | Online Inquiry |
25 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | RBCK1 |
Gene Abbr. | RBCK1 |
Gene ID | 10616 |
Full Name | RANBP2-type and C3HC4-type zinc finger containing 1 |
Alias | C20orf18, HOIL-1, HOIL1, PBMEI, PGBM1 |
Introduction | RBCk1, also known as HOIL-1L, acts as an E3 ubiquitin-protein ligase, or as part of an E3 complex that contains a zf-RanBP (Zn-finger in Ran binding protein) and a zf-C3HC4 (RING finger) domain. RBCk1 catalyzes the ubiquitination and degradation of IRF3. Both RBCk1 and IRF3 are activated by viral infections and IRF3 is a prerequisite trigger for induction of type I Interferons. RBCk1 also negatively regulates TNF and IL1 induced NF-fUB activation. Thus it appears RBCk1 and IRF3 interaction represents a controlling antiviral regulatory channel but also that RBCk1 and ubiquitination pathways also are related to NF-kB and its role as an anti-viral response pathway. |
Product Details | |
---|---|
Host | Mouse |
Clonality | Monoclonal |
Clone No. | CL4289 |
Isotype | IgG1 |
Immunogen | Recombinant Protein corresponding to the following amino acid sequence:SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP. |
Usage | |
---|---|
Application | WB, IHC |
Dilutions | Western Blot (1 µg/mL); Immunohistochemistry (1:50-1:200) |
Reactivity | Human |
Specificity | Specificity of human RBCK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.