Online Inquiry
RAB11FIP5 Antibody
SPA-09420
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | RAB11FIP5 |
| Gene Abbr. | RAB11FIP5 |
| Gene ID | 26056 |
| Full Name | RAB11 family interacting protein 5 |
| Alias | GAF1, RIP11, gaf-1, pp75, rab11-FIP5 |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | 3A8 |
| Isotype | IgG2B Kappa |
| Immunogen | RAB11FIP5 (NP_056285.1, 554 a.a. ~ 652 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SGLEKLKTVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHLTHDELISLLLQRERELSQRDEHVQELESYIDRLLVRIMETSPTLLQIPPGPP. |
| Usage | |
|---|---|
| Application | WB, ELISA |
| Dilutions | Western Blot (1:500) |
| Reactivity | Human |
| Specificity | RAB11FIP5 - RAB11 family interacting protein 5 (class I). |
| Storage & Handling | |
|---|---|
| Storage Buffer | In 1X PBS, pH 7.4. |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.