RAB11FIP5 Antibody - CD BioSciences

service-banner

RAB11FIP5 Antibody

RAB11FIP5 Antibody

SPA-09419

Size Price
0.1 mL Online Inquiry
25 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name RAB11FIP5
Gene Abbr. RAB11FIP5
Gene ID 26056
Full Name RAB11 family interacting protein 5
Alias GAF1, RIP11, gaf-1, pp75, rab11-FIP5
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptide directed towards the N terminal of human RAB11FIP5The immunogen for this antibody is RAB11FIP5. Peptide sequence MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQV. The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Dilutions Western Blot (1:1000)
Reactivity Human, Mouse, Rat, Porcine, Bovine, Canine, Guinea Pig, Rabbit
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.