Online Inquiry
RAB11FIP2 Antibody
SPA-09413
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | RAB11FIP2 |
| Gene Abbr. | RAB11FIP2 |
| Gene ID | 22841 |
| Full Name | RAB11 family interacting protein 2 |
| Alias | Rab11-FIP2, nRip11 |
| Introduction | RAB11FIP2 is a Rab11 effector protein acting in the regulation of the transport of vesicles from the endosomal recycling compartment (ERC) to the plasma membrane.RAB11FIP2 is also involved in receptor-mediated endocytosis and membrane trafficking of recycling endosomes, probably originating from clathrin-coated vesicles. Binds preferentially to phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and phosphatidic acid (PA). |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to RAB11FIP2 (RAB11 family interacting protein 2 (class I)) The peptide sequence was selected from the N terminal of RAB11FIP2. Peptide sequence LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB, IF |
| Dilutions | Western Blot (1:100-1:2000) |
| Reactivity | Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.