Online Inquiry
PTPMT1 Antibody
SPA-09348
Size | Price |
100 µL | Online Inquiry |
200 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | PTPMT1 |
Gene Abbr. | PTPMT1 |
Gene ID | 114971 |
Full Name | protein tyrosine phosphatase mitochondrial 1 |
Alias | DUSP23, MOSP, PLIP, PNAS-129 |
Introduction | This protein phosphatase specifically mediates the dephosphorylation of mitochondrial proteins and consequently plays a central role in ATP production. It probably has a preference for proteins phosphorylated on Ser and/or Thr residues compared to phosphorylation on Tyr residues. It is likely to be involved in the regulation of insulin secretion in pancreatic beta cells. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to the following amino acid sequence: FRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGI. |
Usage | |
---|---|
Application | IF |
Dilutions | Immunofluorescence (0.25-2 µg/mL) |
Reactivity | Human |
Specificity | Specificity of human PTPMT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.