Online Inquiry
PTH1R/PTHR1 Antibody
SPA-09319
| Size | Price |
| 0.05 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | PTH Receptor |
| Gene Abbr. | PTH1R |
| Gene ID | 5745 |
| Full Name | parathyroid hormone 1 receptor |
| Alias | EKNS, PFE, PTHR, PTHR1 |
| Introduction | PTHR1, a Parathyroid Hormone Receptor, mediates PTH-dependent regulation of mineral-ion homeostasis. It also mediates the paracrine action of PTHRP in endochondral bone formation. Mutations in this receptor are responsible for disorders of calcium and bone metabolism such as chondrodysplasia, hypercalcemia, and chronic renal failure. Three promoters, P1, P2, and P3, regulate the expression of PTHR. PTHR1 has been reported to be expressed in bone, breast, brain, colon, GI, kidney, liver, placenta, skin, umbilical cord, and uterus. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: RWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKPGTPALETLETTPPAMAAPKDDGFLNGSCSGLDEEASGPERPPALLQ. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:50-1:200) |
| Reactivity | Human |
| Specificity | Specificity of human PTH1R/PTHR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.