Online Inquiry
PTH Antibody
SPA-09303
Size | Price |
0.1 mg | Online Inquiry |
0.025 mg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | PTH |
Gene Abbr. | PTH |
Gene ID | 5741 |
Full Name | parathyroid hormone |
Alias | FIH1, PTH1 |
Introduction | Parathyroid hormone (PTH), which is also designated parathyrin, is an 84 amino acid single chain peptide that functions to regulate calcium metabolism by raising blood levels of calcium through various mechanisms. PTH stimulates bone formation to increase bone mass and strength in rats and humans. Within the PTH molecule, the essential activity is associated with the first 34 amino acids at the amino-terminus of the molecule. The gene encoding PTH maps to human chromosome 11p15.3-p15.1. Parathyroid hormone-related protein (PTH-rP) is an autocrine factor that is structurally related to PTH yet, unlike PTH, which is synthesized only by the parathyroid cells, PTH-rP is synthesized by several cell types. PTH-rP regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Isolated from the culture medium of a human lung cancer cell line, PTH-rP produces PTH-like effects that are characterized as humoral hypercalcemia of malignancy. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to the following amino acid sequence: KSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAK. |
Usage | |
---|---|
Application | IHC |
Dilutions | Immunohistochemistry (1:1000-1:2500) |
Reactivity | Human |
Specificity | Specificity of human PTH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.