Online Inquiry
PTGER4/EP4 Antibody
SPA-09300
Size | Price |
25 µg | Online Inquiry |
100 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | PTGER4/EP4 |
Gene Abbr. | PTGER4 |
Gene ID | 5734 |
Full Name | prostaglandin E receptor 4 |
Alias | EP4, EP4R |
Introduction | Prostaglandin E receptor EP4 is a Prostanoid Receptor with a relaxing effect on smooth muscle. It may play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function. EP4 has been reported to be expressed in blood, colon, immune tissue, intestine, kidney, lung, ovary, skin, and uterus. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: AASVASRGHPAASPALPRLSDFRRRRSFRRIAGAEIQMV. |
Usage | |
---|---|
Application | WB, IHC |
Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:50-1:200) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human PTGER4/EP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.