Online Inquiry
PRKRIR Antibody
SPA-09248
| Size | Price |
| 0.1 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | PRKRIR |
| Gene Abbr. | THAP12 |
| Gene ID | 5612 |
| Full Name | THAP domain containing 12 |
| Alias | DAP4, P52rIPK, PRKRIR, THAP0 |
| Introduction | P58IPK is an inhibitor of the serine/threonine protein kinase, PKR. P58IPK functions to repress eukaryotic initiation factor 2-alpha subunit (eIF-2alpha) phosphorylation by PKR. PRKRIR, also designated P52RIPK, is a P58IPK interacting protein that abrogates P58IPK mediated suppression of PKR activity. PRKRIR is also known as 52 kDa repressor of the inhibitor of the protein kinase, p58IPK-interacting protein, 58 kDa interferon-induced protein kinase-interacting protein, P52rIPK, death-associated protein 4, THAP domain-containing protein 0, and MGC102750. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: NPHSRHRKRIKELSEDEIRTLKQKKIDETSEQEQKHKETNNSNAQNPSEEEGEGQDEDILPLTLEEKENKEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFE. |
| Usage | |
|---|---|
| Application | WB, IF, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:200-1:500) |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human, mouse, rat PRKRIR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.