Online Inquiry
POLR2J Antibody
SPA-09180
Size | Price |
0.02 mL | Online Inquiry |
0.1 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | POLR2J |
Gene Abbr. | POLR2J |
Gene ID | 5439 |
Full Name | RNA polymerase II subunit J |
Alias | POLR2J1, RPB11, RPB11A, RPB11m, hRPB14 |
Introduction | This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the polymerase. Two similar genes are located nearby on chromosome 7q22.1 and a pseudogene is found on chromosome 7p13. [provided by RefSeq] |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: DPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFR. |
Usage | |
---|---|
Application | IHC |
Dilutions | Immunohistochemistry (1:50-1:200) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human POLR2J antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.