Online Inquiry
PKM2 Antibody
SPA-09398
Size | Price |
25 µg | Online Inquiry |
100 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Pyruvate Kinase M |
Gene Abbr. | PKM |
Gene ID | 5315 |
Full Name | pyruvate kinase M1/2 |
Alias | CTHBP, HEL-S-30, OIP3, PK3, PKM2 |
Introduction | Pyruvate kinase is a glycolytic enzyme that catalyses the conversion of phosphoenolpyruvate to pyruvate. In mammals, the M1 isoform (PKM1) is expressed in most adult tissues. The M2 isoform (PKM2) is an alternatively spliced variant of M1 that is expressed during embryonic development. Research studies found that cancer cells exclusively express PKM2. PKM2 is shown to be essential for aerobic glycolysis in tumors, known as the Warburg effect. When cancer cells switch from the M2 isoform to the M1 isoform, aerobic glycolysis is reduced and oxidative phosphorylation is increased. These cells also show decreased tumorigenicity in mouse xenografts. Recent studies showed that PKM2 is not essential for all tumor cells. In the tumor model studied, PKM2 was found to be active in the non-proliferative tumor cell population and inactive in the proliferative tumor cell population. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: TATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSL. |
Usage | |
---|---|
Application | WB, IF, IHC |
Dilutions | Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:200-1:500) |
MW(KDa) | 60 |
Reactivity | Human, Mouse, Rat |
Validation | Knockdown Validated. |
Specificity | Specificity of human PKM2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.