Online Inquiry
PKCδ Antibody
SPA-08984
| Size | Price |
| 0.1 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | PKC |
| Gene Abbr. | PRKCD |
| Gene ID | 5580 |
| Full Name | protein kinase C delta |
| Alias | ALPS3, CVID9, MAY1, PKCD, nPKC-delta |
| Introduction | Protein Kinase C delta (PKC delta) is a 78 kDa member of the novel group (nPKCs: sensitive to diacylglycerol, phosphatidylserine, and phorbol esters) of the PKC family of serine/threonine kinases that are involved in a wide range of physiological processes including mitogenesis, cell survival and transcriptional regulation. PKC delta is an ubiquitously expressed PKC isozyme that has been implicated in the regulation of multiple cellular processes including cell cycle progression and apoptosis. Autophosphorylation of serine 664 (serine 662 in mouse and rat) contributes to PKC delta activity. Serum dependent phosphorylation of serine 664 is mediated by mTOR pathway, is protected from dephosphorylation by phosphorylated threonine 505 in the activation loop, and is implicated in prolactin signaling. |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | 2E12 |
| Isotype | IgG2A Kappa |
| Immunogen | PRKCD (NP_006245, 577 a.a. ~ 676 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED. |
| Usage | |
|---|---|
| Application | WB, ELISA, IF |
| Dilutions | Western Blot (1:500); Immunofluorescence (1:10-1:500); ELISA (1:100-1:2000) |
| MW(KDa) | 77 |
| Reactivity | Human |
| Specificity | PRKCD - protein kinase C, delta. |
| Storage & Handling | |
|---|---|
| Storage Buffer | In 1X PBS, pH 7.4. |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.