Online Inquiry
PHPT1 Antibody
SPA-08843
Size | Price |
100 µL | Online Inquiry |
50 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | PHPT1 |
Gene Abbr. | PHPT1 |
Gene ID | 29085 |
Full Name | phosphohistidine phosphatase 1 |
Alias | CGI-202, HEL-S-132P, HSPC141, PHP, PHP14 |
Introduction | PHPT1 is a 125 amino acid enzyme belonging to the Janus protein family. Existing as a monomer in the cytoplasm, PHPT1 is an EDTA-insensitive phosphohistidine phosphatase. Overexpression of PHPT1 leads to specific phosphohistidine phosphatase activity towards phosphopeptide I, with no activity detected towards phosphotyrosine, phosphothreonine and phosphoserine peptides. Recombinant human PHPT1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Immunogen | Synthetic peptide directed towards the C-terminal region of PHPT1. Peptide sequence: DCECLGGGRISHQSQDRKIHVYGYSMGYGRAQHSVSTEKIKAKYPDYEVT The peptide sequence for this immunogen was taken from within the described region. |
Usage | |
---|---|
Application | WB |
Reactivity | Mouse, Human, Rat, Bovine, Canine, Guinea Pig, Rabbit |
Storage & Handling | |
---|---|
Storage Buffer | PBS, 2% Sucrose. |
Preservative | 0.09% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.