PHPT1 Antibody - CD BioSciences

service-banner

PHPT1 Antibody

PHPT1 Antibody

SPA-08838

Size Price
100 µL Online Inquiry
50 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name PHPT1
Gene Abbr. PHPT1
Gene ID 29085
Full Name phosphohistidine phosphatase 1
Alias CGI-202, HEL-S-132P, HSPC141, PHP, PHP14
Introduction PHPT1 is a 125 amino acid enzyme belonging to the Janus protein family. Existing as a monomer in the cytoplasm, PHPT1 is an EDTA-insensitive phosphohistidine phosphatase. Overexpression of PHPT1 leads to specific phosphohistidine phosphatase activity towards phosphopeptide I, with no activity detected towards phosphotyrosine, phosphothreonine and phosphoserine peptides. Recombinant human PHPT1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: DLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYE.
Usage
Application IF, IHC
Dilutions Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:500-1:1000)
Reactivity Human
Specificity Specificity of human PHPT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.