Online Inquiry
Pentraxin 3/TSG-14 Antibody
SPA-08770
| Size | Price |
| 0.1 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Pentraxin 3 |
| Gene Abbr. | PTX3 |
| Gene ID | 5806 |
| Full Name | pentraxin 3 |
| Alias | TNFAIP5, TSG-14 |
| Introduction | Pentraxin 3 (PTX3), also known as TNF-stimulated gene 14 (TSG-14), is a secreted glycoprotein belonging to the Pentraxin family of proteins. It is the prototypical long Pentraxin, exhibiting a C-terminal Pentraxin domain characteristic of the family, and a unique N-terminal domain. It is produced by several cell types including endothelial and mononuclear cells. PTX3 acts as a pattern recognition receptor with non-redundant roles in the innate immune response to several microbial agents including the fungal pathogen Aspergillus fumigatus. Overexpression leads to enhanced pro-inflammatory responses. PTX3 is induced in response to LPS and inflammatory cytokines including TNF-alpha and IL-1 beta. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: GFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:200-1:500) |
| Reactivity | Human, Rat |
| Specificity | Specificity of human Pentraxin 3/TSG-14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.