Online Inquiry
PDZK1 Antibody
SPA-08754
Size | Price |
0.1 mL | Online Inquiry |
25 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | PDZK1 |
Gene Abbr. | PDZK1 |
Gene ID | 5174 |
Full Name | PDZ domain containing 1 |
Alias | CAP70, CLAMP, NHERF-3, NHERF3, PDZD1 |
Introduction | Scaffold or adaptor proteins recruits and/or anchor their binding partners to specific subcellular locations, serving as a platform to regulate interactions between proteins involved in diverse signal transduction pathways, and PDZK1 (PDZ domain-containing protein 1) is a scaffold protein belonging to NHERFs family. PDZK1 expression is largely limited to epithelial cells and is mainly expressed in renal proximal epithelial cells, hepatocytes, and at a lower level in other epithelial as well as certain endothelial cells. PDZK1 has four PDZ domains which facilitates its interaction with its binding partners, including ion transporters (e.g. CFTR, OCTN1/OCTN2 etc) and several GPCRs (e.g. HTR2B, SSTR family members). Through its interaction with HDL and SR-BI, PDZK1 can play role in reverse cholesterol transport and for HDL-mediated vascular re-endothelialisation. When complex with SLC9A3R1, PDZK1 cluster proteins that are functionally dependent in a mutual fashion and modulate the trafficking as well as the activity of associated membrane proteins. PDZK1 plays a role in cellular mechanisms associated with multidrug resistance through its interaction with ABCC2 and PDZK1IP1. PDZK1 also implicates in connecting SCARB1 with cellular machineries for intracellular cholesterol transport and/or metabolism and regulation of proximal tubular Na+-dependent inorganic phosphate cotransport. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: EDASHEEVVEKVKKSGSRVMFLLVDKETDKRHVEQKIQFKRETASLKLLPHQPRIVEMKKGSNGYGFYLRAGSEQKGQIIKDIDSGSPAEEAGLKNNDLVVAVNGESVET. |
Usage | |
---|---|
Application | WB, IHC |
Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:50-1:200) |
Reactivity | Human |
Specificity | Specificity of human PDZK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.