Online Inquiry
PDHK2 Antibody
SPA-08711
| Size | Price |
| 0.1 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | PDHK2 |
| Gene Abbr. | PDK2 |
| Gene ID | 5164 |
| Full Name | pyruvate dehydrogenase kinase 2 |
| Alias | PDHK2, PDKII |
| Introduction | PDK2 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to PDK2(pyruvate dehydrogenase kinase, isozyme 2) The peptide sequence was selected from the middle region of PDK2. Peptide sequence ELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (0.2-1 µg/mL); Immunohistochemistry (1:10-1:500) |
| Reactivity | Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.