PDHK2 Antibody - CD BioSciences

service-banner

PDHK2 Antibody

PDHK2 Antibody

SPA-08710

Size Price
0.1 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name PDHK2
Gene Abbr. PDK2
Gene ID 5164
Full Name pyruvate dehydrogenase kinase 2
Alias PDHK2, PDKII
Introduction PDK2 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.
Product Details
Host Mouse
Clonality Monoclonal
Clone No. 2G1
Isotype IgG2A Kappa
Immunogen PDK2 (AAH05811, 187 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM.
Usage
Application WB, ELISA, IHC
Dilutions Western Blot (1:500); Immunohistochemistry (1:10-1:500); ELISA (1:100-1:2000)
Reactivity Human
Specificity PDK2 - pyruvate dehydrogenase kinase, isoenzyme 2.
Storage & Handling
Storage Buffer In 1X PBS, pH 7.4.
Preservative No Preservative
Storage Temp. Aliquot and store at -20 °C or -80 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.