Online Inquiry
PDHK2 Antibody
SPA-08710
Size | Price |
0.1 mg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | PDHK2 |
Gene Abbr. | PDK2 |
Gene ID | 5164 |
Full Name | pyruvate dehydrogenase kinase 2 |
Alias | PDHK2, PDKII |
Introduction | PDK2 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism. |
Product Details | |
---|---|
Host | Mouse |
Clonality | Monoclonal |
Clone No. | 2G1 |
Isotype | IgG2A Kappa |
Immunogen | PDK2 (AAH05811, 187 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM. |
Usage | |
---|---|
Application | WB, ELISA, IHC |
Dilutions | Western Blot (1:500); Immunohistochemistry (1:10-1:500); ELISA (1:100-1:2000) |
Reactivity | Human |
Specificity | PDK2 - pyruvate dehydrogenase kinase, isoenzyme 2. |
Storage & Handling | |
---|---|
Storage Buffer | In 1X PBS, pH 7.4. |
Preservative | No Preservative |
Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.