Online Inquiry
p70 S6 Kinase/S6K Antibody
SPA-08487
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | p70 S6K |
| Gene Abbr. | RPS6KB1 |
| Gene ID | 6198 |
| Full Name | ribosomal protein S6 kinase B1 |
| Alias | PS6K, S6K, S6K-beta-1, S6K1, STK14A |
| Introduction | p70 S6 kinase is a mitogen activated Ser/Thr protein kinase that is required for cell growth and G1 cell cycle progression. p70 S6 kinase phosphorylates the S6 protein of the 40S ribosomal subunit and is involved in translational control of 5' oligopyrimidine tract mRNAs. A second isoform, p85 S6 kinase, is derived from the same gene and is identical to p70 S6 kinase except for 23 extra residues at the amino terminus, which encode a nuclear localizing signal. Both isoforms lie on a mitogen activated signaling pathway downstream of phosphoinositide-3 kinase (PI-3K) and the target of rapamycin, FRAP/mTOR, a pathway distinct from the Ras/MAP kinase cascade. The activity of p70 S6 kinase is controlled by multiple phosphorylation events located within the catalytic, linker and pseudosubstrate domains. Phosphorylation of Thr229 in the catalytic domain and Thr389 in the linker domain are most critical for kinase function. Phosphorylation of Thr389, however, most closely correlates with p70 kinase activity in vivo. Prior phosphorylation of Thr389 is required for the action of phosphoinositide 3-dependent protein kinase 1 (PDK1) on Thr229. Phosphorylation of this site is stimulated by growth factors such as insulin, EGF and FGF, as well as by serum and some G-protein-coupled receptor ligands, and is blocked by wortmannin, LY294002 (PI-3K inhibitor) and rapamycin (FRAP/mTOR inhibitor). Ser411, Thr421 and Ser424 lie within a Ser-Pro-rich region located in the pseudosubstrate region. Phosphorylation at these sites is thought to activate p70 S6 kinase via relief of pseudosubstrate suppression. Another LY294002 and rapamycin sensitive phosphorylation site, Ser371, is an in vitro substrate for mTOR and correlates well with the activity of a partially rapamycin resistant mutant p70 S6 kinase. |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | 4H4 |
| Isotype | IgG1 Kappa |
| Immunogen | RPS6KB1 (NP_003152, 416 a.a. ~ 525 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL. |
| Usage | |
|---|---|
| Application | WB, ELISA, IF |
| Dilutions | Western Blot (1:500); Immunofluorescence (1:10-1:2000); ELISA (1:100-1:2000) |
| MW(KDa) | 70 |
| Reactivity | Human, Mouse, Rat |
| Storage & Handling | |
|---|---|
| Storage Buffer | In 1X PBS, pH 7.4. |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.