NUDT14 Antibody - CD BioSciences

service-banner

NUDT14 Antibody

NUDT14 Antibody

SPA-08229

Size Price
0.1 mL Online Inquiry
25 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name NUDT14
Gene Abbr. NUDT14
Gene ID 256281
Full Name nudix hydrolase 14
Alias UGPP, UGPPase
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the middle region of Human NUDT14. Peptide sequence: SRQTMFYTEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPK The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Reactivity Human, Mouse, Rat, Equine, Guinea Pig
Storage & Handling
Storage Buffer PBS, 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.