NPRL3 Antibody - CD BioSciences

service-banner

NPRL3 Antibody

NPRL3 Antibody

SPA-08186

Size Price
0.1 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name NPRL3
Gene Abbr. NPRL3
Gene ID 8131
Full Name NPR3 like, GATOR1 complex subunit
Alias C16orf35, CGTHBA, FFEVF3, HS-40, MARE
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the N terminal region of human NPRL3. Peptide sequence: NKLLFRYPFQRSQEHPASQTSKPRSRYAASNTGDHADEQDGDSRFSDVIL The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Reactivity Human
Storage & Handling
Storage Buffer PBS, 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.