Online Inquiry
Nodal Antibody
SPA-08153
| Size | Price |
| 0.05 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Nodal |
| Gene Abbr. | NODAL |
| Gene ID | 4838 |
| Full Name | nodal growth differentiation factor |
| Alias | HTX5 |
| Introduction | NODAL is an important TGF-beta family protein in cellular differentiation. While constitutively expressed in many developing tissues, NODAL is problematically associated with the differentiation and development of many cancers. The expression of NODAL is regulated by a Notch signaling pathway, which when disrupted contributes to the aggressive behavior of metastatic cancer cells, particularly in melanoma. The abundance of NODAL expression in melanoma can help determine the stage of cancer and metastatic type/progression when tested in IHC. NODAL interactions with Cripto also predispose toward tumor progression. Overexpression of NODAL is also associated with preeclamptic placenta. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: PTEGSLAIEIFHQPKPDTEQASDSCLERFQMDLFTVTLSQVTFSLGSMVL EVTRPLSKWLKHPGALEKQMSRV. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:50-1:200) |
| Reactivity | Human |
| Specificity | Specificity of human Nodal antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.