Online Inquiry
NKIRAS2 Antibody
SPA-08128
Size | Price |
0.1 mg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | NKIRAS2 |
Gene Abbr. | NKIRAS2 |
Gene ID | 28511 |
Full Name | NFKB inhibitor interacting Ras like 2 |
Alias | KBRAS2, kappaB-Ras2 |
Introduction | NF-kB is silenced in the cytoplasm by an inhibitory protein, IkB. Synthesis of IkBa is autoregulated. IkB proteins are phosphorylated by IkB kinase complex consisting of at least three proteins, IKK1/a, IKK2/b, and IKK3/g. External stimuli such as tumor necrosis factor or other cytokines results in phosphorylation and degradation of IkB releasing NF-kB dimers. NF-kB dimer subsequently translocates to the nucleus and activates target genes. Six members of IkB family members have been identified. One of the first genes induced following NF-kB activation is IkBa. Recently, two proteins, kB-Ras1 and kB-Ras2 have been identified. These two proteins interact with PEST domains of IkBa and IkBb and decrease their rate of degradation. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Synthetic peptides corresponding to NKIRAS2(NFKB inhibitor interacting Ras-like 2) The peptide sequence was selected from the middle region of NKIRAS2. Peptide sequence KKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLE. The peptide sequence for this immunogen was taken from within the described region. |
Usage | |
---|---|
Application | WB |
Dilutions | Western Blot (0.2-1 µg/mL) |
Reactivity | Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit |
Storage & Handling | |
---|---|
Storage Buffer | PBS and 2% Sucrose. |
Preservative | 0.09% Sodium Azide |
Storage Temp. | Store at -20 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.